PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr020281.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family CO-like
Protein Properties Length: 460aa    MW: 51075.4 Da    PI: 5.0553
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr020281.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box24.27.1e-081659340
     zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                 +r C+ +  k++++fC  ++ +lC+ C    H+       H++v
  Pbr020281.1 16 ARACDSCLVKRARWFCAADDAFLCQRCDALVHSAnqlasrHQRV 59
                 678**************************99*657788888876 PP

2CCT67.82.8e-23390433144
          CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                  Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk++
  Pbr020281.1 390 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRT 433
                  9*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.311461IPR000315B-box-type zinc finger
SMARTSM003363.7E-101461IPR000315B-box-type zinc finger
PfamPF006431.4E-61659IPR000315B-box-type zinc finger
CDDcd000213.31E-91761No hitNo description
PROSITE profilePS5101716.083390432IPR010402CCT domain
PfamPF062036.3E-18390432IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 460 aa     Download sequence    Send to blast
MITDKKAANA MGGNTARACD SCLVKRARWF CAADDAFLCQ RCDALVHSAN QLASRHQRVR  60
LQGSSVKANA SVQLIADQAA PAWHKGFKRK ARTPRHNKKP GFAAKDEQEK VGLHPPLPFV  120
PEIGCQETNL MEDEENEDLE RLLYRVPIYD PFAAELCNIS SSDQVGNNTG AIDLDDEEIE  180
IRNTGNDLDN LGGFLRSDME LAEFAADVEN LLGGGLDEDC SDIKGILGLL DEGKEVKVEE  240
EVEGIEFNPS ILDWNLYYEQ SSAVPVLMGS EEDKEEEEKV VLFMGAQSSD EIGFMENKQI  300
VMKRKNICLK LDYEAVITAW ASQGSPWTTG TRPELNPDEG WLDCMGMWPT EIHQAHGDSA  360
GLQGMWPTEI HQAHGDSAGC VSGRGDDPRR EARVSRYREK RRTRLFSKKI RYEVRKLNAE  420
KRPRMKGRFV KRTTSSFGGV GSSSSNAPAA AFPYLMINK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1400416RRTRLFSKKIRYEVRKL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009347093.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 6-like
TrEMBLM5WFD00.0M5WFD0_PRUPE; Uncharacterized protein
STRINGPOPTR_0015s06480.11e-133(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14733392
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68520.18e-76B-box type zinc finger protein with CCT domain